SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014638 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014638
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-28
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014638   Gene: ENSOCUG00000017037   Transcript: ENSOCUT00000017035
Sequence length 80
Comment pep:novel scaffold:oryCun2:GL018786:916181:917102:-1 gene:ENSOCUG00000017037 transcript:ENSOCUT00000017035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLFQGLVTFRDVAVEFSQEEWKCLKPAQRDLYRDVTLENFGNLVSLGISISKPDIISL
LEQGKEPWTIANDITGPWCP
Download sequence
Identical sequences ENSOCUP00000014638 9986.ENSOCUP00000014638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]