SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014808 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014808
Domain Number 1 Region: 20-75,102-356
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-47
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000271
Further Details:      
 
Domain Number 2 Region: 362-475
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.95e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000655
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014808   Gene: ENSOCUG00000017234   Transcript: ENSOCUT00000017236
Sequence length 476
Comment pep:novel chromosome:oryCun2:2:77025667:77071023:1 gene:ENSOCUG00000017234 transcript:ENSOCUT00000017236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRDMMCARMQRSLPAGVTAYDYLVIGGGSGGLASSPEAELGARAAVVESHKLGGTCVNVG
CVPKKVMWNTAMHSEFMHDHVDYGFQSCEGKFNWRVIKEKRDAYVSRLNTIYQNNLTKSH
IDIIHGYAAFTSDPEPTVEVNGNKYTAPHILIATGGVPSRPHESQIPGASLGITSDGFFE
LEELPRRSVVVGAGYIAVEIAGIFSALGSKTSLMIRHDKVLRNFDSLISSNCTEELENSG
VEVLKHSQVKEVKQTSSGLEVCMVTAAPGRKPTFTTIPNVDCLLWAIGRDPNSSGLNLNN
VGIKTDDKGHVVVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGRKLAHRLFECKKDSKL
DYDNIPTVVFSHPPIGTVGLTEDEAIYKYGKENVKTYSTSFTPMYHAVTTRKTKCVMKMV
CANREEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSAEELVTLR
Download sequence
Identical sequences G1TD98
ENSOCUP00000014808 ENSOCUP00000014808 9986.ENSOCUP00000014808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]