SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015148 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015148
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-66
Family GDI-like N domain 0.0000000000712
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.34e-16
Family GDI-like N domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015148   Gene: ENSOCUG00000017639   Transcript: ENSOCUT00000017639
Sequence length 447
Comment pep:known scaffold:oryCun2:GL018816:113937:119642:-1 gene:ENSOCUG00000017639 transcript:ENSOCUT00000017639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE
GPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETA
EPEKEVEPALELLEPIDQKFVAISDLYEPIDDGSESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGSAFDFENMKRKQNDVFGEADQ
Download sequence
Identical sequences B7NZQ6 P50398
ENSRNOP00000053135 NP_001164849.1.1745 NP_058784.2.100692 NP_058784.2.4139 XP_004672172.1.11716 XP_006992498.1.50099 ENSOCUP00000015148 ENSOCUP00000015148 10116.ENSRNOP00000053135 9986.ENSOCUP00000015148 ENSRNOP00000053135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]