SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015192 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015192
Domain Number 1 Region: 821-899
Classification Level Classification E-value
Superfamily DEATH domain 4.04e-19
Family DEATH domain, DD 0.0000628
Further Details:      
 
Domain Number 2 Region: 127-218
Classification Level Classification E-value
Superfamily Immunoglobulin 5.96e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 217-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000549
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 273-320
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 20-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000264
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015192   Gene: ENSOCUG00000017691   Transcript: ENSOCUT00000017691
Sequence length 924
Comment pep:novel chromosome:oryCun2:2:71999778:72241208:-1 gene:ENSOCUG00000017691 transcript:ENSOCUT00000017691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADSGEALPDSIPSAPGTLPHFIEEPDDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQ
NEHVSEESLDESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRI
AYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADH
NLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQK
RSRTCTNPAPLNGGAFCEGMSVQKITCTSLCPVDGSWELWSEWSVCSPECEHLRIRECTA
PPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAA
VVAVAVLVVGVTLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLT
VSRTYSGPICLQDPLDKELMTESSLFNPLSDIKVKVQSSFMVSLGVSERADYHGKNHPGT
FPHGNNRSFTTMHPRNKAPYIQNLSSLPTRTELRTTGVFGHLGGRLVMPNTGVSLLIPHG
AIPEENSWEIYMSINQGEPSLQSDGSEVLLSPEVTCGPPDMVVTTPFALTIPHCADVSSE
HWNIHLKKRTQQGKWEEVMSVEDESTSCYCLLDPFACHVLLDSFGTYALTGEPITDCAVK
QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHHGGQLLEEPKLLHFKGNTFS
LQISVLDIPPFLWRIKPFTACQEVPFSRVWSSNRQPLHCAFSLERYTPTTTQLSCKICIR
QLKGHEQILQVQTSILESERETITFFAQEDSTFPAQTGPKAFKIPYSIRQRICATFDTPN
AKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGRTH
TKLSNISESQLDEADFNYSRQNGL
Download sequence
Identical sequences 9986.ENSOCUP00000022388 ENSOCUP00000015192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]