SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015784 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015784
Domain Number 1 Region: 130-217
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-18
Family DEATH domain, DD 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015784   Gene: ENSOCUG00000025559   Transcript: ENSOCUT00000032128
Sequence length 225
Comment pep:known chromosome:oryCun2:9:15011551:15014415:1 gene:ENSOCUG00000025559 transcript:ENSOCUT00000032128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQNSHHSKDMAFVDRSLRGQDGDGDGVRTGAGTALAFNTSSSFPDEPPEGSGNIIPVYC
ALLATVVLGLLAYVAFKCWRSHKQRRQLAKARTAELGGLDRDQRHENSVFLDSPSDPSQG
PQYEPGCRLYLHLPRQQQEEAERLLEVSGEADKGWRGLAGRLGYPPEAVETMAQGQTPAY
TLLRDWATQEGSRATLRVLEEVLAAMGREDVVQALSPPAEGCSVV
Download sequence
Identical sequences G1TFT8
ENSOCUP00000015784 ENSOCUP00000015784 XP_002713379.1.1745 9986.ENSOCUP00000015784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]