SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015832 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015832
Domain Number 1 Region: 1-237
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.51e-57
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0039
Further Details:      
 
Domain Number 2 Region: 312-491
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.76e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015832   Gene: ENSOCUG00000005169   Transcript: ENSOCUT00000031488
Sequence length 539
Comment pep:novel chromosome:oryCun2:13:23383281:23406499:1 gene:ENSOCUG00000005169 transcript:ENSOCUT00000031488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRVAVVGAGVSGLAAIRCCLEEGLQPTCFERSDDVGGLWKFSDHAEEGRASIYQSVFT
NSSKEMMCFPDFPYPEDYPNYMHHSKLQEYIKSFAQKKNLLRYIQFETLVSSIQKGPSFL
VTGQWVVITEKDGKQESTIFDAVMVCSGHHVYPNLPTGSFPGLDQFRGNHLHSRDYKGPE
AFKGKRVLVIGLGNSGSDIAVELSRLATQVIISTRSGSWVMSRVWDEGYPWDMVYVTRFA
SFLQSILPSFVSDWLYTKKMNTWFKHENYGLMPLNGPLRKEPVFNDELPARILCGTVSIK
PNVKEFTETSAIFEDGTMFEAIDSVIFATGYEYAYPFLDDSIIKSRNNEVTLFKGIFPPL
IEKPTLAVIGLVQSLGAAIPTADLQARWAAKVFANSCTLPTANEMMADIDEKMGKKLKCI
FFPFLRFGQSNTLQTDYITYMDELGSFIGAKPNIPWLFLTDPQLALEVFFGPCSPYQFRL
MGPGKWDGARNAILTQWSRTVKPTRMRTICEAQRPHYFCSLLKMLSFSVLLLAAWLALY
Download sequence
Identical sequences 9986.ENSOCUP00000004481 ENSOCUP00000015832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]