SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016024 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016024
Domain Number 1 Region: 63-366,533-568
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-51
Family FAD-linked reductases, N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016024   Gene: ENSOCUG00000026865   Transcript: ENSOCUT00000025873
Sequence length 608
Comment pep:novel chromosome:oryCun2:2:100880353:100888746:1 gene:ENSOCUG00000026865 transcript:ENSOCUT00000025873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLWLVLLAVLLAGLRKVYLGLFAGSSPNPFSEDVKRPPAPLVTDREARKKVLRQVFSAS
QVPEKLDVVVIGSGIGGLAAAAILAKAGKRVLVLEQHTKAGGCCHTFGKNGLEFDTGIHY
IGRMQEGSTGRFILDQITEGQLDWAAMCSPFDIVVLEGPNGRKEFPMYSGEEAYIRGLKE
KFPQEEAAIDKYMKLVKVVSSGAIHAILLKFLPLPLAQLLSRCRLLIRFSPFLRASTQSL
AEVLQQLGVSPELHAVLSYIFPTYGVTPSHTTFAMHALLVDHYLKGGFYPRGGSSEIAFH
IIPVIERAGGAVLTKATVQSVLLDSAGKVCGVSVKKGPQLVNVYCPIVISSAGLFNTYEK
LLPEGARSLPGVRQQLRMVRPGLGMFSVFICLRGTKEELGLQSTNYYVYFDTDMDKAMER
YISLPREKAANHIPLLFIASPSAKDPTWEDRFPDRSTMIVLVPSAFKWFEEWQEEPKGKR
SRDYETLKSAFVEASMSVVMRLFPHLEGKVDSAIGGSPLTNQFYLAAPRGACYGADHDLG
RLHPHAMASLRAQSPIPNLYLTGQDIFTCGLMGALQGALLCSSAILKRNLYSDLKDLGSR
IQAQKKKN
Download sequence
Identical sequences G1TGH4
ENSOCUP00000016024 ENSOCUP00000016024 XP_002709724.1.1745 9986.ENSOCUP00000016024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]