SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016025 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000016025
Domain Number - Region: 128-187
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000837
Family beta-sandwich domain of Sec23/24 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016025   Gene: ENSOCUG00000021890   Transcript: ENSOCUT00000024598
Sequence length 365
Comment pep:novel chromosome:oryCun2:18:50766425:50780048:1 gene:ENSOCUG00000021890 transcript:ENSOCUT00000024598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERSRLLGGMALLLLQALPSPLSARAEPPQDKEACVGTNNQSYICDTGHCCGQSQCCNYY
YELWWFWLVWTIFILLSCCCVCHHRRAKHRLQAQQRQHEINLIAYREAHNYSALPFYFRF
LPNYLLPPYEEVVNRPPTPPPPYSAFQLQQQQQLPPQCGPAGGSPAGPDPTRGSQGAQSS
PLSGPSRSSTRPPSIADPEPSDMPADQAAPKASQVEPSGSVAGLGELDPVAFLDKDSECK
EELLKEDSSEHGSALPDSKDKTPGRHRRFTGDSGIEVCVCNRGHHDDDLKEFSTLIDDAL
DGPLDFCDSCHVRPPGDEEEALCQPSEEQAHEPGHPHLPRPPACLLLNTINEQDSPNSQS
SSSPS
Download sequence
Identical sequences G1TMY0
ENSOCUP00000018346 ENSOCUP00000016025 9986.ENSOCUP00000018346 XP_002718630.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]