SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016710 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000016710
Domain Number - Region: 467-524
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0523
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016710   Gene: ENSOCUG00000002176   Transcript: ENSOCUT00000029236
Sequence length 721
Comment pep:novel chromosome:oryCun2:17:58776281:58782383:1 gene:ENSOCUG00000002176 transcript:ENSOCUT00000029236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGNLL
LRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQESDPEDDDVKKPALQSSVVATS
KERTRRDLIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQ
AEEERKQVENERRELFEERRAKQTELRLLEQKVELAQLQEEWNEHNAKIIKYIRTKTKPH
LFYIPGRMCPATQKLIEESQRKMNALFEGRRIEFAEQINKMEARPRRQSMKEKEHQVVRN
EEQKAEQEEGKVAQREEEMEETGNQHNDVEIEEAGEEEEKEVGVVHSDAEKEQEEEEQKQ
EVEVKMEEEPEVRESEKQQDSQPEEVMDVLEMVENVQNVIAEQEAMETNQVESTEPSENE
TSKELEPEMEFEVEPDKESKSLSPEKESVGALEIEKESEGKEEKEPEPQPEPVAQPQTQP
QPQPQPQPQLQPQTQPQPQSVLQPQPETLPAAVLQPPPQVIQEQGHLLPERKEFPVESVK
LTEVPIEPVLTAHPESKSKTKTRSRSRGRARNKTSKSRSRSSSSSSSSSSSTSSSSGSSS
SSGSSSSRSSSSSSTSTSGSSSRDSSSSTTSSSESRSRSRGRGHNRDRKHRRSVDRKRRD
TSGLERSHKSSKGGSSRDTKGSKDKNSRSDRKRSISESSRSGKRSSRSERDRKSDRKDKR
R
Download sequence
Identical sequences G1SGZ7
9986.ENSOCUP00000001881 ENSOCUP00000016710 ENSOCUP00000001881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]