SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017352 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017352
Domain Number 1 Region: 754-1053
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-64
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 2 Region: 479-752
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.09e-59
Family Tandem AAA-ATPase domain 0.0000322
Further Details:      
 
Domain Number 3 Region: 358-422
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000843
Family Chromo domain 0.023
Further Details:      
 
Domain Number 4 Region: 434-497
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000726
Family Chromo domain 0.0061
Further Details:      
 
Domain Number 5 Region: 51-118
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000118
Family beta-sandwich domain of Sec23/24 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017352   Gene: ENSOCUG00000010822   Transcript: ENSOCUT00000027018
Sequence length 2274
Comment pep:known chromosome:oryCun2:17:41664160:41701121:-1 gene:ENSOCUG00000010822 transcript:ENSOCUT00000027018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKGESKRITLVLQQPQSGGPQGHRHVVLGSLPGKIVLQGNQLAALTQAKNAQGQPAKVVT
IQLQVQQPQQKIQIVPQPPSSQPQPQQPPATQPLTLSSVQQAQIMGPGQSPGQRLSVPLK
MVLQPQAGSSQGASSGLSVVKVLSASEVAALSSPANSAPHTGKTGMEENRRLEHQKKQEK
ANRIVAEAIARARARGEQNIPRVLNEDELPSVRPEEEGEKKRRKKSTGERLKEEKPKKSK
TSGASKTKGKSKLNTITPVVGKKRKRNTSSDNSDVEVMPAQSPREDEESSIQKRRSNRQV
KRKKYTEDLDIKITDDEEEEEVDVTGPIKPEPILPEPVQEPDGETLPSMQFFVENPSEED
AAIVDKVLSMRVVKKELPSGQYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLKR
FKTKMAQMRHFFHEDEEPFNPDYVEVDRILDESHSIDKDNGEPVIYYLVKWCSLPYEDST
WELKEDVDEGKIREFKRIQSRHPELKRMNRPQASAWKKLELSHEYKNRNQLREYQLEGVN
WLLFNWYNRQNCILADEMGLGKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNT
WTEMNTIVYHGSLASRQMIQQYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELREI
EWRCVIIDEAHRLKNRNCKLLDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQFP
SESEFLKDFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKY
YRAILEKNFSFLSKGAGHTNMPNLLNTMMELRKCCNHPYLINGAEEKILTEFREACHIIP
HDFHLQAMVRSAGKLVLIDKLLPKLKAGGHKVLIFSQMVRCLDPLTRFLCDLLYRYLYER
IDGRVRGNLRQAAIDRFSKPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQ
AQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQF
SKKEIEDLLRKGAYAAIMEEDDEGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFV
ASENRTDISLDDPNFWQKWAKKADLDMDLLNSKNNLVIDTPRVRKQTRHFSTLKDDDLVE
FSDLESEDDERPRSRRHDRHHAYGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERD
VETICRAILVYCLLHYRGDENIKGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKV
KSQSTFDIHKADWIRKYNPDTLFQDESYKKHLKHQCNKVLLRVRMLYYLRQEVIGDQAEK
VLGGAIASEIDIWFPVVDQLEVPTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLE
KAGRPDDKAIAAEHRVLDNFSDIVEGVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDE
EISVIDGDEAQVTQQPGHLFWPPGSALTARLRRLVTAYQRSYKREQMKIEAAERGDRRRR
RCEAAFKLKEIARREKQQRWTRREQTDFYRVVSTFGVEYDPDTMQFHWDRFRTFARLDKK
TDESLTKYFHGFVAMCRQVCRLPPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLRE
QVLCHPLLEDRLALCQPPGPELPKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFL
AARMNYMQNHQAGAPAPSLSRCSTPLLHQQYTSRTASPLPLRPDAPVEKSPEETAAQVPS
LESLTLKLEHEVVARSRPTPQDYEVRVAPSDTTPLVSRNIPPVKLEDEDDSDSELDLSKL
SPSSSSSSSSSSSSSSTDESEDEKEEKLTADHSRSKLYDEESLLSLTMSQDGFPNEDGEQ
MTPELLLLQERQRASEWPKDRVLINRIDLICQAVLSGKWPSSRRNQEMITGGILGPANHL
LESPSLTPGEYGDSPVPTPRSSSAASMAEEEASAVTTAAAQFTKLRRGMDEKEFTVQIKD
EEGLKCTISEAQCDGLRTCRSRNRVEHYIKGIRKMVLDHVASTQTLQWYLFFTSQDRVLI
NRIDLICQAVLSGKWPSSRRNQEMITGGILGPANHLLESPSLTPGEYDQRCKLTTAKDIN
SFGYPTLEASNKAEALKGHHAETVFNRVLPGPIAPESSKKRARRTRPDLSKMMALMQGGG
TGSLSLHNTFQHSSGGLQSVSSLGHSSATSASLPFMPFVMGGAASSPHVDSSTMHPGLRA
TGYPSSPATTTSGTALRLPSLQLSQGYDSSERDFSLIDDPMMPANSDSSEDADD
Download sequence
Identical sequences ENSOCUP00000017352 9986.ENSOCUP00000009322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]