SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017657 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000017657
Domain Number - Region: 3-33
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00262
Family KRAB domain (Kruppel-associated box) 0.016
Further Details:      
 
Domain Number - Region: 58-114
Classification Level Classification E-value
Superfamily Geminin coiled-coil domain 0.0915
Family Geminin coiled-coil domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017657   Gene: ENSOCUG00000027634   Transcript: ENSOCUT00000022819
Sequence length 127
Comment pep:novel scaffold:oryCun2:AAGW02077230:204155:207315:1 gene:ENSOCUG00000027634 transcript:ENSOCUT00000022819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRNVLLQVLVSLLSLGYCVTKPDVIFKLEQGAEPWTVEEPPQQSLQVVQKMDDLTGTS
QENQGITFWEVVVVNNNTSTEERVELRKTCDLNSNHISKLVVKNEDYSEVRPEAFNVYQN
EILPSEP
Download sequence
Identical sequences 9986.ENSOCUP00000017657 ENSOCUP00000017657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]