SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018588 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018588
Domain Number 1 Region: 3-217
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.75e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 2 Region: 160-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.47e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.013
Further Details:      
 
Domain Number 3 Region: 310-495
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000371
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018588   Gene: ENSOCUG00000002788   Transcript: ENSOCUT00000022793
Sequence length 541
Comment pep:novel chromosome:oryCun2:13:23491391:23516187:1 gene:ENSOCUG00000002788 transcript:ENSOCUT00000022793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLDYLKMYADRFDLLKCIQFKTTVFSITKCQDFN
VSGQWEVVTLHEGKQESAIFDAVMVCTGFLTNPHLPLGCFPGIKTFKGQYFHSRQYKHPD
IFKDKRVLVVGMGNSGTDIAVEASHVAKKVFLSTTGGAWVISRVFDSGYPWDMVFTTRFQ
NFIRNSLPTPIVTWLVAKKMNSWFNHANYGLVPKDRIQLKEPVLNDELPGRIITGKVFIR
PSIKEVKENSVVFGNAHNTPSEEPIDVIVFATGYTFAFPFLDESVVKVEDGQASLYKYIF
PAHLQKPTLAVIGLIKPLGSMLPTGETQARYTVQVFKGVIKLPPTSVMIKEVNERKENKH
NGHLLQKRGFHLWYALGYHAVHLRTFVPLLSSIYASKLQVLIYPCQSVKFQXFFGPYSPY
QFRLTGPGKWKGARNAIMTQWDRTFKVTKTRIVQESSSPFESLLKLFAVLALLVSVFLIF
L
Download sequence
Identical sequences G1TNL3
ENSOCUP00000018588 ENSOCUP00000018588 9986.ENSOCUP00000018588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]