SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018718 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018718
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.44e-64
Family TRADD, N-terminal domain 0.000000165
Further Details:      
 
Domain Number 2 Region: 220-302
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000443
Family DEATH domain, DD 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018718   Gene: ENSOCUG00000025249   Transcript: ENSOCUT00000028181
Sequence length 303
Comment pep:novel chromosome:oryCun2:5:22770515:22772477:-1 gene:ENSOCUG00000025249 transcript:ENSOCUT00000028181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPNGCQEWVGSAYLFVESSLDTVVLSDIYAQPQQKVAVYRALRTALAESGGSPDVVQ
MLKIHRSDPQLVVQLRFCGRQRCGRFLHAYREGALRVALQKRLAAALQRHSLPLRLELRA
GSELLDAWLTDEERCLSCILAQKPDRLRDEELAELEDALRNLTCSPEGQGGGVEVVLAPS
QPLVPSPSEEKPSPPAPVHTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPVLDSLAYEYERDGLYEQAFQLLQRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGL
Download sequence
Identical sequences G1TNY9
ENSOCUP00000018718 9986.ENSOCUP00000018718 ENSOCUP00000018718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]