SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018787 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018787
Domain Number 1 Region: 587-597,631-1009
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.09e-79
Family Formin homology 2 domain (FH2 domain) 0.0001
Further Details:      
 
Domain Number 2 Region: 125-344
Classification Level Classification E-value
Superfamily ARM repeat 8.86e-26
Family Diap1 N-terninal region-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000018787
Domain Number - Region: 577-620
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018787   Gene: ENSOCUG00000010039   Transcript: ENSOCUT00000027111
Sequence length 1163
Comment pep:novel chromosome:oryCun2:5:22834307:22849851:-1 gene:ENSOCUG00000010039 transcript:ENSOCUT00000027111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGDDRGDGEPASLVTVRVQYLEDTDPFACANFPEPRRAPTCTLDGALPLGAQIPTLHR
LLGAPLKLEDCALQVSPSGYYLDPELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRV
NAILEKLYGSSGPELRRSLFSLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQTYI
LRALGQLMLFVDGMLGVVAHSETVQWLYTLCASLSRLVVKTALKLLLVFVEYAENNAPLL
IRAVNSVASITGALPWANLVSILEEKNGADPELLVYTVTLINKTLAALPDQDSFYDVTDA
LEQQGMEALVQRLLGTAGTDVDLRTQLMLYESALRLEDGDLEEAAAAAAAGGRRERRKPS
SEEGKRSRRSLEGGGCAVRAPEPGPTGPASPTGSSSSVTSPTPLAGPASSPVSPVSPTSG
LRTSVNLFPTISTAPSADSSFERSVYKARFLENVAAAETEKQAALAQGRAEALAGAVPDE
ADGHPDTREPWDSPEAAPIPRTPQSPTPRVLLRVQRSLESEPKEPPTPPSPKDKPIQALP
TRVPKLCIGDLDFSDLGEDEDQDMLNVESVDAGKGVPPPPPLLPGGPPPPPPPPPPPIKG
PFPPPPPLAAPFPPSAPDGPALPTKRKTVKLFWRELKLAGGHGSPGSRFGPCPTLWASLE
PVSVDTARLEHLFESRAKDVLPSKKAGEGRRTMTTVLDPKRSNAINIGLTTLPPVHVIKA
ALLNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMTLASIGGLA
ARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVHNATFRCILATLLAVGNFLNGSQSRG
FELSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPDSSDLYSEIPALTRCAKVDFEQLTEN
LGQLERRSRAAEESLRSLAKHELAPALRARLTHFLAQCGRRVAMLRVVHRRVCNRFHAFL
LYLGYTAQAAREVRIMQFCHTLREFALEYRTCRERVLQQQQKRATYRERNKTRGRMITET
EKFSGVAGEAPSNPPVPVAVGSGPGQDDANSHASMKSLLTTRPEDTTHNRRSRGMVQSSS
PATPTAGPSTAPSEEPPGSSDTSDEIMDLLVQSVTRSSPRALAARERKRSRGNRKSLRRT
LKSGLGDDLVQALGLSKAPGLEV
Download sequence
Identical sequences G1TP57
XP_002711656.1.1745 ENSOCUP00000018787 9986.ENSOCUP00000018787 ENSOCUP00000018787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]