SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018804 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018804
Domain Number 1 Region: 170-244
Classification Level Classification E-value
Superfamily Homeodomain-like 2.01e-26
Family Homeodomain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000018804
Domain Number - Region: 62-111
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0445
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018804   Gene: ENSOCUG00000026941   Transcript: ENSOCUT00000024107
Sequence length 303
Comment pep:novel scaffold:oryCun2:GL018710:2081034:2158109:1 gene:ENSOCUG00000026941 transcript:ENSOCUT00000024107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG
SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQTLSPAEVEKRSGGKRKSDSSDSQEGNYKS
EVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK
WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANEDSHDSDHSSEH
AHL
Download sequence
Identical sequences G1TP72
XP_002720881.1.1745 ENSOCUP00000018804 ENSOCUP00000018804 9986.ENSOCUP00000018804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]