SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018855 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018855
Domain Number 1 Region: 595-702
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 131-509
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 6.41e-32
Family Soluble quinoprotein glucose dehydrogenase 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018855   Gene: ENSOCUG00000023484   Transcript: ENSOCUT00000028262
Sequence length 706
Comment pep:novel scaffold:oryCun2:GL018761:35306:56304:-1 gene:ENSOCUG00000023484 transcript:ENSOCUT00000028262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAALARRLGALAARVEAALWACAGYALDLLCQECSPYAAHLYDAEDPSTPLRTLPGLCQD
YCQDMWHTCRGLFRHLSPDRELWALEGNQAKFCRYLSLDDVDYCFPRLLVNQNLNSNLGR
VVADARGCLQLCLEEVANGLRNPVAMVHAGDGSHRFFVAEQVGLVWAYLPDGARLEKPFL
NVSRAVLTSPWEGDERGFLGLAFHPRFRLTGKLYVYYSVGVDFREWIRISEFRISEDDEN
AVDHSSERIILEIEEPASNHNGGQLLFGDDGYLYIFTGDGGMAGDPFGKFGNAQNKSALL
GKVLRIDVDRNERGPLYRIPPDNPFVGDPAARPEVYALGVRNMWRCSFVFCGDVGQNKFE
EVDLVERGRNYGWRAREGFECYDRKLCANASLDDVLPIFAYPHKLGKSVTGGYVYRGCEY
PNLNGLYIFGDFMSGRLMSLRENEGTGQWQYSEICMGRGQTCAFPGLINNYYPHIISFAE
DEAGELYFMSTGVPSATAARGVIYKVIDPSRRAPPGKCQIQPAQVKVRSRLIPFVPKEKF
IWTTESTPRPTLRPTAHTPTKAPRRSRPTKKEVSLFFYRIIYGRGHDATESPRMAPVRLV
RPAGLGPGRGRVEVFVGGRWGTVCDDAWDAKAAAVVCRQLGFAHAVRAAKRAEFGEGRAL
PILLDDVRCTGSERNLLECAHAGVGTHNCDHQEDAGVECSRQDPDL
Download sequence
Identical sequences G1TPC2
ENSOCUP00000018855 ENSOCUP00000018855 9986.ENSOCUP00000018855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]