SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019143 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000019143
Domain Number - Region: 47-94
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00288
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019143   Gene: ENSOCUG00000003425   Transcript: ENSOCUT00000030385
Sequence length 1178
Comment pep:novel chromosome:oryCun2:5:29338217:29461648:-1 gene:ENSOCUG00000003425 transcript:ENSOCUT00000030385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACGRVRRMFRLSAALPLLLLAAAGAQKVPGQGVHGQGQGAGVNAVPFAGQAGGGGPAG
PQLPPSSQQQQQQQQQQQQPPQPPQPPFPAGGPPARRGGAGPGGAGGGWKLAEEESCRED
VTRVCPRHTWSNNLAVLECLQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVCK
STISEIKECADEPVGKGYLVSCLVDHRGNITEYQCHQYITKMTAIIFSDYRLICGFMDDC
KNDINILKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEEKEPKIQVSELCKKAILRVAEL
SSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEKCREALTTRQKL
IAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQG
EMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNCQ
QALQTLIQETDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVED
CEHRLLELQYFISRDWKLDPVLYRKCQGDASRLCHTHGWNETSELMPPGAVFSCLYRHAY
RTEEQGRRLSRECRAEVQRILHQRAMDVKLDPALQDKCLIDLGKWCSEKTETGQELECLQ
DHLDDLAVECRDIVGNLTELESEDIQIEALLMRACEPIIQNFCHDVADNQIDSGDLMECL
IQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNIKKKVDVVICLS
TTVRNDTLQEAKEHRVSLKCRKQLRVEELEMTEDIRLEPDLYEACKSDIKNYCSTVQYGN
AQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTML
QCLKQNKNSELMDPKCKQMITKRQITQNTDYRLNPVLRKACKADIPKFCHGILSKAKDDS
ELEGQVISCLKLRYADQRLSSDCEDQIRVIIQESALDYRLDPQLQLHCSDEISSLCAEEA
AAQEQTGQVEECLKVNLLKIKTEMCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAA
ITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTS
PSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR
Download sequence
Identical sequences ENSOCUP00000019143 9986.ENSOCUP00000002979 XP_002711767.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]