SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019427 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019427
Domain Number 1 Region: 64-308,416-478
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-40
Family FAD-linked reductases, N-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019427   Gene: ENSOCUG00000026364   Transcript: ENSOCUT00000028357
Sequence length 486
Comment pep:novel chromosome:oryCun2:1:90807726:90813338:-1 gene:ENSOCUG00000026364 transcript:ENSOCUT00000028357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGVLQLGLGRGLLTRGLGSRGGGSTVDWDEKVSEVKKKIKSMLPGEICDPLYDTSHLP
PEQSDVVIVGGGVVGLSVAFWLKKLEKRRGAIRVLVVERDHTYAQASTGLSVGGIRQQFS
LPENVQLSLFSINFLRNINEYLAVVDAPPLDLQFNPSGYLLLASEKSASTLENNVKVQRQ
EGAKICLMSPEQLRNKFPWINTEGVALASYGMEDEGWFDPWSLLQGLRRKVQSMGVLFCQ
GEVTRFVSSSSRMETTSGEEIIMKRIREVHVKMDNSLEYQPVECAIVINAAGAWSGKIAE
LAGVGKGPPGTLQGTKLPVEPRKRYVYLWHCPQGPGLETPFVADTNGVYFRREGLGNNYL
GGRSPTEEEEPDPSNLEVDHDFFQEKVWPQLAQRVPAFENLKVRSSWAGYYDYNTFDQNG
VVGPHPLVVNMYFATGFSGHGLQHAPAVGRAVAEMVLEGHFQTIDMSPFLFSRFHLGEKV
LEQNIF
Download sequence
Identical sequences G1TQY0
ENSOCUP00000019427 XP_002708349.1.1745 ENSOCUP00000019427 9986.ENSOCUP00000019427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]