SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020266 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020266
Domain Number 1 Region: 236-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.29e-27
Family GDI-like 0.0000232
Further Details:      
 
Domain Number 2 Region: 9-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.67e-16
Family GDI-like N domain 0.000000184
Further Details:      
 
Domain Number 3 Region: 331-367
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000142
Family GDI-like N domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020266   Gene: ENSOCUG00000024645   Transcript: ENSOCUT00000030275
Sequence length 382
Comment pep:novel chromosome:oryCun2:16:15028946:15030233:-1 gene:ENSOCUG00000024645 transcript:ENSOCUT00000030275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLPSPACLLGTGLQECIKSGIRSVNAKKVLPMDQNPYYGEKSASITPLEDLYRRLKISGS
PPSCGEKDWNVDLIPKFLMTNGLMGLFEKCCFRKFLVHVANFDEKKLDLLKTAMQDMYKK
SDLGQDVIDFTGHALDLHRTDDYLDQPCCKTIHRIKLYGESLARSKSLYLYLLYGLRELP
QGFARPTAIYRGTYMLNKPMEGVIVQNGKVVGVKSEGGVAQCKQLIWDSSYVKDRVEKAG
QAIRVSCILSQPIKNTNDANSCQIIIPQIQVNRKCLISSAHNVAAQGYIAMVSTTVGSKE
PEKEVRPALELLEPTEQKFVSISDLHVQGLGKESQIFIFCTYDAIIHFETTCDDIGDICK
RMTRSEFIQGMKPKKNDIYGEG
Download sequence
Identical sequences G1TT96
ENSOCUP00000020266 ENSOCUP00000020266 9986.ENSOCUP00000020266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]