SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020973 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020973
Domain Number 1 Region: 122-479
Classification Level Classification E-value
Superfamily ARM repeat 4.13e-110
Family Diap1 N-terninal region-like 0.0000000106
Further Details:      
 
Domain Number 2 Region: 647-1024
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.88e-109
Family Formin homology 2 domain (FH2 domain) 0.00000000296
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000020973
Domain Number - Region: 576-630
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00654
Family beta-sandwich domain of Sec23/24 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020973   Gene: ENSOCUG00000001719   Transcript: ENSOCUT00000021015
Sequence length 1191
Comment pep:novel chromosome:oryCun2:8:61242223:61495071:-1 gene:ENSOCUG00000001719 transcript:ENSOCUT00000021015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERHRPRLHHPGHASVAGTPYPSSASLRSCRESKMTRRKGPQHPPPPGGPEEPGEKRPKF
HLNIRTLTDDMLDKFASIRIPGSKKERPPLSSLKTAFGSSDCSLASSEMMENVPKPLAQN
EVLELFEKMMEDMNLNEDKKAPLREKDYSIKKEMVMQYINTASKTGSLKSSRQISPQEFI
HELKMGPADERLVTCLESLRVSLTSNPVSWVESFGCDGLGILLDILEKLIRGKTQENIVK
KNQHKVIQCLKALMNTQYGLERIMSEERSLSLLAKAMDPKHPSMMTDVVKLLSAVCIVGE
ESILEDVLEALTSAGEERKIDRFSSIVEGLRHNSAQLQVACMQLINALVTSPDDLDFRLH
IRNEFMRCGLKEILPNLKRIKNDGLDIQLKVFDEHKEEDLIEFSHRLEDIRAELEYPFDV
YNMLWNTVKETEAEGYFISILQHLLLIRNDYFIRQQYFRLIDECVSQIVLHRDGMDPDFT
YRKRLDLNLSQFVDVCIDQAKLEEFEEKASELTKKFEKEFTDHQETQAQLQKKEAKINEL
QAELQAFKSQFGALPADKSIPLTSKEAGSGHPAPPPAPPLPSCGGVPPPPPPPPPPPLPG
MPMPLGGPVPPPPPLGFLGPNSPPPPALPFGLKPKKEFKPEINMRRLNWLKIRPQEMTEN
CFWIKVNETKFENADLLCKLENTFCCQQREKREEEDFEEKKAIKKKIKELKFLDSKIAQN
LSIFLSSFRVPYEEIKMMILEVDETQLAESMIQNLIKHLPDQEQLNSLSQFKSDYNNLCE
PEQFAVVMSNVKRLRPRLSAILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLEL
VLLMGNYMNAGSRNAQTFGFNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILNFVD
DLEHLDKASRVSVETLEKNLKQMGRQLQQLEKDLETFPPPEDLHDKFVTKMSIFVTDAKE
QYGNLSKLHANMEKLYQSVMGYYAIDVKKVSVEDFFTDLNNFRTAFMQAVKENIKKREAE
EKEKRARIAKELAEKERLERQQKKKRLLEMKTEGDETGVMDSLLEALQSGAAFRDRRKRT
PKPKDLRQSLSPMSQRPVLKVCNHENQKVQLTEGSRTHYNINCNSTRTPAAKELNYNLDT
HTSTGRIKAVEKKDACNVESNRKKEMELLGSVSKSESVPEVEALLARLRAL
Download sequence
Identical sequences G1SG00
ENSOCUP00000020973 ENSOCUP00000001477 9986.ENSOCUP00000001477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]