SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021120 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021120
Domain Number 1 Region: 26-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000129
Family KRAB domain (Kruppel-associated box) 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021120   Gene: ENSOCUG00000022431   Transcript: ENSOCUT00000031710
Sequence length 140
Comment pep:novel scaffold:oryCun2:GL018804:469828:475103:1 gene:ENSOCUG00000022431 transcript:ENSOCUT00000031710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAAPAEPSPGADAGQARGKPEVQDAFRDISIYFSKEEWAEMGEWEKSRYRNVKRNYCA
LVAIGLRAPRPAFMCHRRLAVRARADDTEDSDEEWTPRQQVKPPWMAFRTEHSKHQKLCK
RLCLFSSSSSQVFTLPHLHL
Download sequence
Identical sequences 9986.ENSOCUP00000021120 ENSOCUP00000021120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]