SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022109 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022109
Domain Number 1 Region: 129-207
Classification Level Classification E-value
Superfamily DEATH domain 0.000000412
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022109   Gene: ENSOCUG00000022288   Transcript: ENSOCUT00000021383
Sequence length 216
Comment pep:novel chromosome:oryCun2:16:26137224:26223098:1 gene:ENSOCUG00000022288 transcript:ENSOCUT00000021383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRTTKQMGRGTKQPAGHQEDHMAKEPVEDTDPSTLSFNMSDKYPIQDTGLPKAEECDT
VTLNCPPNSDEQHQGEENGFPDSTGDPLSDVSKDKPCHENCTCSSCSLRAPTISDLLNDQ
DLLDVIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRTVGQL
MELCRLYHRADVEKVLRRWVEEEWPKRERGDYSRHF
Download sequence
Identical sequences G1TYE5
ENSOCUP00000022109 XP_017203201.1.1745 9986.ENSOCUP00000022109 ENSOCUP00000022109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]