SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022579 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022579
Domain Number 1 Region: 491-736
Classification Level Classification E-value
Superfamily vWA-like 2.11e-71
Family Trunk domain of Sec23/24 0.0000697
Further Details:      
 
Domain Number 2 Region: 243-399,739-802
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.16e-47
Family beta-sandwich domain of Sec23/24 0.006
Further Details:      
 
Domain Number 3 Region: 873-1014
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 4.71e-36
Family C-terminal, gelsolin-like domain of Sec23/24 0.00067
Further Details:      
 
Domain Number 4 Region: 402-487
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 2.62e-25
Family Zn-finger domain of Sec23/24 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022579   Gene: ENSOCUG00000023881   Transcript: ENSOCUT00000027861
Sequence length 1018
Comment pep:novel chromosome:oryCun2:18:13736457:13760868:-1 gene:ENSOCUG00000023881 transcript:ENSOCUT00000027861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVNQSAPPVPPFGQPQPVYPGYHQSSYGGQPGPTAPHIPYGAYNGPVPGYQQTPPQGVS
RAPPSSGPPPASTAQAACGQAAYAQLGQGDVQNGPSSTVQMQRLPGSQPFGSPLAPVVSQ
PAVLQPYGPPPTSAQVTAQLAGMQISGAAAPAPPPSGLGYGPPTSLASASGSFPNSGLYG
SYPQGQAPPLSQTQGHPGVQPPQRSALPLASSFTPPSSGGPRMPSMTGPLLPGQGFGGPP
VSQPNHVSSPPPQALPPGTQMTGAPGPPPPMHSPQQPGYQLQQNGSFGPARGPQPNYGSP
YPGAPAFGSQPGPPQPLPPKRLDPDAIPSPIQVIEDDRNNRGSEPFVTGVRGQVPPLVTT
NFLVKDQGNASPRYIRCTSYNIPQVPLAAVIKPLARLPPEEASPYVVDHGESGPLRCNRC
KAYMCPFMQFVEGGRRFQCCFCSCVNDVPPQYFQHLDHTGKRVDAYDRPELSLGSYEFLA
TVDYCKNNKFPSPPAFIFMIDVSYNAIRTGLVRLLCEELKSLLDFLPREGGAEESAVRVG
FVTYNKVLHFYNVKSSLAQPQMMVVSDVADVFVPLLDGFLVNVNESRAVITSLLDQIPEM
FADTRETETVFAPVIQAGMEALKAAECAGKLFLFHTSLPIAEAPGKLKNRDDRKLINTDK
EKTLFQPQTGAYQTLAKECVAQGCCVDLFLFPNQYVDVATLSVVPQLTGGSVYKYACFQA
ENDQERFLSDLRRDVQKVVGFDAVMRVRTSTGIRAVDFFGAFYMSNTTDVELAGLDGDKT
VTVEFKHDDRLNEESGALLQVAGQRQGPGRKCGMSVSGYKKAAGKRVRSGERGLAEEAEG
RDFIIEHRGXDRAYVRQLVTSIDVAETNVFFYPRLLPLTKSPIESTTEPPAVRASEERLS
SGDIYLLENGLNLFLWVGASVQQGVVQSLFSVASFSQITSGLSVLPVLDNPLSKKVRGLI
DSLRAQRSRYMKLIVVKQEDKLEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS
Download sequence
Identical sequences G1TZQ5
ENSOCUP00000022579 ENSOCUP00000022579 9986.ENSOCUP00000022579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]