SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023943 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023943
Domain Number 1 Region: 31-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-26
Family Ribosomal protein S14 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023943   Gene: ENSOCUG00000027982   Transcript: ENSOCUT00000029351
Sequence length 128
Comment pep:novel chromosome:oryCun2:1:181040693:181041079:1 gene:ENSOCUG00000027982 transcript:ENSOCUT00000029351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAVAVVGCVLRRFQQMVPLSASGQIRGYYLDWKTSRDLKRGKLAYEYADERLRINSLRKN
TILPKDLQEVADEEIAALPWDSCPVRIRNRCAMTSRPRGVKRRCRLSHIVFCHLADHGQL
SGVQRAMW
Download sequence
Identical sequences G1U3I0
ENSOCUP00000023943 9986.ENSOCUP00000023943 ENSOCUP00000023943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]