SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024200 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024200
Domain Number 1 Region: 2-237,341-415
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.02e-71
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000631
Further Details:      
 
Domain Number 2 Region: 220-337
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.39e-39
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000692
Further Details:      
 
Domain Number 3 Region: 432-519
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 3.27e-26
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024200   Gene: ENSOCUG00000023573   Transcript: ENSOCUT00000023918
Sequence length 519
Comment pep:known scaffold:oryCun2:GL018897:354927:377163:-1 gene:ENSOCUG00000023573 transcript:ENSOCUT00000023918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGS
DWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLKFGKGGQAHRCC
CVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAK
NTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEC
RGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPEKDHVYLQLHHL
PPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLRHVNGQDQI
VPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPPIKPNAGEE
SVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKISQLYGDLKHLKT
FDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRG
Download sequence
Identical sequences G1U7G6
9986.ENSOCUP00000025370 ENSOCUP00000025370 ENSOCUP00000024200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]