SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024321 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024321
Domain Number 1 Region: 233-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000124
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 266-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000543
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024321   Gene: ENSOCUG00000009813   Transcript: ENSOCUT00000021789
Sequence length 302
Comment pep:novel chromosome:oryCun2:7:147884112:147933600:-1 gene:ENSOCUG00000009813 transcript:ENSOCUT00000021789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLRASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPTSSSLD
SYAAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVAAAGAVKSGQSDSEQGGVGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI
Download sequence
Identical sequences G1SXZ0
ENSOCUP00000008453 XP_002712642.1.1745 ENSOCUP00000024321 9986.ENSOCUP00000008453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]