SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024538 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024538
Domain Number 1 Region: 432-539
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000533
Further Details:      
 
Domain Number 2 Region: 139-247
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 3 Region: 2-108
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000514
Further Details:      
 
Domain Number 4 Region: 290-395
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 5 Region: 692-797
Classification Level Classification E-value
Superfamily SRCR-like 1.03e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000655
Further Details:      
 
Domain Number 6 Region: 577-688
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-33
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 7 Region: 813-922
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-33
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024538   Gene: ENSOCUG00000013488   Transcript: ENSOCUT00000026564
Sequence length 1210
Comment pep:novel chromosome:oryCun2:18:69391891:69408238:1 gene:ENSOCUG00000013488 transcript:ENSOCUT00000026564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELRLANGGDRCQGRVEVLYQGSWGTVCDDGWDVNDAQVVCRQLGCGMAVSAPGSARFGQ
GPGQIVLDDVSCSGQEAYLWSCHHRGWLSHNCGHQEDAGVICSGAMDTTTPLPGSVHQFW
TTVSHEPLSTEGADVFPSGLELRLANGGDRCQGRVEVLYQGSWGTVCDDGWDVNDAQVVC
RQLGCGMAVSAPGSARFGQGPGQIVLDDVSCSGQELYLWSCHHRGWLSHNCGHQEDAGVI
CSGAMDTTTPLPVHQFWTTVSHEPLSTEGADDTWPTTVIYESTPVHISGLQLRLVNGSDR
CEGRVEVLYQGSWGTVCDDSWDLNDASVVCRQLGCGTALSAPASAQFGQGSGSIVLDDVS
CSGSEPNLWSCSHRGWLSHNCGHHEDAGVVCSETEWCSCGAGCWWGSVTAPVLPALSKRG
QPGWLPDPGPDSRLAVRLVNGSTRCQGRVEVLYRGSWGTVCDDSWDINDASVVCRQLGCG
WAVSAPGSARFGQGSGSIFLDEVSCSGQEPYLWNCSHRGWLSHNCGHYEDAGVICSGLML
SFSLLLITDGWTTVTPPAPTTDWWEPTVTTTVGPSSNCGGFLYNATGSFSSPSYPGYYPN
NALCVWEIAVPSGYLINLGFSQLRLEQHSYCDFDYVEIFDGSLNSSLLGKICNDSGQIFT
TSSNRMTVLFRSDISVQNTGFLAWYNSFPRDASLRLVSGNSSYGACAGRVEIYHGGRWGT
VCDDSWDTQDAQVVCRQLQCGDAVSAPGGAYFGSGSGPITLDDVNCSGTEATLWQCRSQS
WFSHNCGHHEDASVICTVLLCPTSPPQMTASYSCGGFLSQHSGRFSSPFYPGNYPNNARC
VWDIEVQNNYQVTVTFTDVQLEGGCQYDYIEVFDGPYHSSPLIARVCDGARGSFTSSSNF
LSVRFVSDGSITRRGFQAEFYSLPSNDSTNLLCLMNHMQASVSRAYLQSLGFSAWDLVVS
GWNGTYQCQRQITPSQVIFTIPYSGCGTIKQVDNDTITYSNFLKAAVSSGVIKRKKDLHI
HVSCRMLQDSWVHTMYIANDTIEVSEVQYSNFNVNVSFYTSSSFSYPVTSSPYYVDLDQN
LYLQAEILHSDASLALFVDTCVASPNPNDFTSVTYDLIRSGCVRDETYRSYAQPSPRVVR
FRFNSFHFLNRFPAVYLRCKMVVCRAYDYSSRCYRGCVVRSKRDVGSYQERVDVVLGPIQ
LLDPPAGKKS
Download sequence
Identical sequences G1T5J0
9986.ENSOCUP00000011615 ENSOCUP00000024538 ENSOCUP00000011615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]