SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000024865 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000024865
Domain Number 1 Region: 1-310,414-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-76
Family FAD-linked reductases, N-terminal domain 0.000000000112
Further Details:      
 
Domain Number 2 Region: 290-400
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.16e-36
Family L-aminoacid/polyamine oxidase 0.000000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000024865   Gene: ENSOCUG00000001436   Transcript: ENSOCUT00000024021
Sequence length 520
Comment pep:novel chromosome:oryCun2:X:29182998:29252030:-1 gene:ENSOCUG00000001436 transcript:ENSOCUT00000024021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSKCDVVVVGGGISGMAAAKLLHDSGLNVIVLEARDRVGGRTYTIRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPAVWNPITYLDHNNLWR
IMDEMGQEIPSDAPWKAPLAEEWDHMTMKELLDKICWTESAKKLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIMSTTNGGQERKFVGGSGQVSERIMDLLGERVKLERPVIRIDQ
TGENVLVETLNHEIYEAKYVISAIPPVLGMKIHYNPPLPMMRNQLITRVPLGSIIKCMVY
YKEPFWRKKDYCGTMIIEGEEAPIAYTLDDTKPDGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSQEALQPVHYEEKNWCEEQYSGGCYTTYFPPGIMTQYGRVLRQAVGR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAIGKIPEDEIWQSEPESVDVPARPITTT
FLERNLPSVPGLLRLIGLTTMFSAVALGFLAYKRGLLVRV
Download sequence
Identical sequences G1SFF7
XP_002719918.2.1745 9986.ENSOCUP00000001239 ENSOCUP00000024865 ENSOCUP00000001239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]