SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025468 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025468
Domain Number 1 Region: 175-289
Classification Level Classification E-value
Superfamily Acid proteases 1.46e-27
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 1-44
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000067
Family Ubiquitin-related 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025468   Gene: ENSOCUG00000023891   Transcript: ENSOCUT00000028152
Sequence length 348
Comment pep:novel scaffold:oryCun2:GL018791:664829:685120:-1 gene:ENSOCUG00000023891 transcript:ENSOCUT00000028152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVYAERPLTDNHRSLASYGLKDGDVVILRQKENADPRPPVQFPSLPRIDFSSIAVPGTSS
PRQRPPAAVKPSHSSGEMAASPQGLDNPALLRDMLLANPHELSLLKERNPPLAEALLSGD
LERFSRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAP
ESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGT
QKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTG
SQTTFLPEGELPECARLAYGAVRPEEIADQELAEAIQKSAEDAERQKP
Download sequence
Identical sequences G1U603
ENSOCUP00000025468 9986.ENSOCUP00000024839 ENSOCUP00000024839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]