SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000025884 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000025884
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-61
Family GDI-like N domain 0.000000000278
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.96e-16
Family GDI-like N domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000025884   Gene: ENSOCUG00000025405   Transcript: ENSOCUT00000025701
Sequence length 445
Comment pep:known chromosome:oryCun2:10:33491645:33492982:-1 gene:ENSOCUG00000025405 transcript:ENSOCUT00000025701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDQNPYYGGESASITPLEDLYKRFKIPG
SPPSSMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDENDARTFEGVDPKKTAMRDEYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCCETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVVGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGKESQIFISRTYDATTHFETTCDDIKDI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences G1U8W6
ENSOCUP00000025884 9986.ENSOCUP00000025884 ENSOCUP00000025884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]