SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oryctolagus cuniculus 69_2 > ENSOCUP00000026030

Domain assignment for ENSOCUP00000026030 from Oryctolagus cuniculus 69_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOCUP00000026030
Domain Number 1	Region: 208-287
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.0000000000000618
Family	DEATH domain, DD	0.023
Further Details:

Domain Number 2	Region: 37-84
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.000000000000746
Family	TNF receptor-like	0.0065
Further Details:

Domain Number 3	Region: 104-161
Classification Level	Classification	E-value
Superfamily	TNF receptor-like	0.00000000000104
Family	TNF receptor-like	0.0023
Further Details:

Domain Number 4	Region: 294-372
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.000000268
Family	DEATH domain, DD	0.041
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOCUP00000026030 Gene: ENSOCUG00000011150 Transcript: ENSOCUT00000021947
Sequence length	402
Comment	pep:known chromosome:oryCun2:3:134829065:134839450:-1 gene:ENSOCUG00000011150 transcript:ENSOCUT00000021947 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	SSNWIANSIRLFLDISIKWTMQETLPPKYLHYDPETSRQLMCDKCPPGTYLKQHCTARRE TLCTPCPDHYYTDTWHTSEECLYCSSVCKELQHVKQECNRTHNRVCECEEGRYLDLEFCV KHRSCPPGFGVAQAGTPERNTVCKRCPDGFFSDEMSSKAPCRKHTNCSALGLLLTQKGNA THDNVCSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGSKVNAESVER IKRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQDIDLCENSVQRHIGHANLTLDQLRSLM ESLPGKKVGAEAIEKARRACKSSEQLPKLLSLWRTKNGDQDSLKGLMHALKHLKTYHFPK SVTQSLRKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences	ENSOCUP00000026030 9986.ENSOCUP00000026030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]