SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000026171 from Oryctolagus cuniculus 69_2

(show help)
Strong hits

Sequence:	ENSOCUP00000026171
Domain Number 1	Region: 8-69
Classification Level	Classification	E-value
Superfamily	KRAB domain (Kruppel-associated box)	2.88e-26
Family	KRAB domain (Kruppel-associated box)	0.00098
Further Details:

Domain Number 2	Region: 227-284
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	8.51e-26
Family	Classic zinc finger, C2H2	0.0028
Further Details:

Domain Number 3	Region: 367-424
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.22e-25
Family	Classic zinc finger, C2H2	0.0033
Further Details:

Domain Number 4	Region: 423-480
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.28e-25
Family	Classic zinc finger, C2H2	0.0039
Further Details:

Domain Number 5	Region: 311-368
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.12e-25
Family	Classic zinc finger, C2H2	0.0035
Further Details:

Domain Number 6	Region: 465-517
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	5.49e-19
Family	Classic zinc finger, C2H2	0.0047
Further Details:

Domain Number 7	Region: 274-306
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.0000000000304
Family	Classic zinc finger, C2H2	0.0068
Further Details:

Weak hits

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

External link(s)	Protein: ENSOCUP00000026171 Gene: ENSOCUG00000029052 Transcript: ENSOCUT00000032995
Sequence length	537
Comment	pep:novel chromosome:oryCun2:5:1321049:1339386:-1 gene:ENSOCUG00000029052 transcript:ENSOCUT00000032995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAVGLLKAMYQELVTFGDVAVDFSQEEWDCLDSSQRHLYSNVMLENYSVLVSLGLCFSKP SVILLLEQGKEPWMVKRELTKGLCSGWESMCEIEELIPKQGLSDEQSSRKITDKLPSYGF EYSSLREELKCKDHFERQSGNQKAGLKEETITYEEGLVDARQQEYKKSWESFPQNTLLRT QQIIPKEEKVRKYNTHKKSFKKTVMTIKPKTVYAEKKLLKCNDCEKVFSQSSSLTLHQRI HTGEKPYKCVECGKAFSQRSNLVQHHRIHTGEKPYECKECRKAFSQNAHLVQHLRVHTGE KPYECKVCRKAFSQFAYLAQHQRVHTGEKPYECIECGKAFSNRSSIAQHQRVHTGEKPYE CNVCGKAFSLRAYLTVHQRIHTGERPYECKECGKAFSQNSHLAQHQRIHTGEKPYKCQEC RKAFSQIAYLAQHQRVHTGEKPYECIKCGKAFSNDSSLTQHQRVHTGEKPYECNVCGKAF SYCGSLAQHQRIHTGERPYECKECKKTFRQHAHLAHHQRIHTGESLPPPNPANHQVL
Download sequence
Identical sequences	G1U9P9 ENSOCUP00000026171 ENSOCUP00000026171 XP_002711538.1.1745 XP_008255398.1.1745

SEARCH