SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000000544 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000000544
Domain Number 1 Region: 530-560,657-735
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000235
Family Anti-sigma factor antagonist SpoIIaa 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000000544   Gene: ENSOCUG00000000624   Transcript: ENSOCUT00000000627
Sequence length 752
Comment pep:novel chromosome:oryCun2:9:16317150:16324771:-1 gene:ENSOCUG00000000624 transcript:ENSOCUT00000000627 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLEKSGRPRDTQALLSATQAMELQRRDYHVERPLLNQQQLEELGHWGPAPRTHQWRTWL
QCSRARAYALLLRHFPILAWLPRYPVRDWLLGDVLSGLSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAIMSVMVGSVTESLAPDEDFMDIANSTVNETAR
DTYRVQLASTLSVLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVFISQLKYVFG
LQLSSRSGPLSLIYTVLEVCWKLPQTVGTLVTALVAGVVLEKAPRSLPLPLIASLSSLIG
ATAISYGVGLQQRFGVDVVGNIPAGLVPPVAPNPQLFAKLVGNAFAIAVVGFAIAISLGK
IFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNTQIAGAISSL
FLLLIILKLGELFRDLPKAVLAAAIIVNLKGMLMQFKDIPSLWKANQMDLLIWLVTFVAT
ILLNLDLGLAVAIVFSLLLTVVRTQLPRYSVLGQVTDTDIYRDLAEYAEAREVPGVKVFR
SSATLFFANAEFYSDALKQRCGVDVDYLLSRKKKLMKKRELQQKRLKKNKRPRTQAAPSK
DTSVSVNVNASPEDIKSNDVDDSRAKVNPAAELEDAVASNQEDAKAPNGSTLKALGLPQP
DFHSLVLGSESPFVDTVCIKSLKNIFRDFREIEVEVYIAACHSPVVAQLEAGHFFDGSIT
KQHLFVSVHDAVTFALQHPRSDPSRPVLATKL
Download sequence
Identical sequences G1SDQ3
ENSOCUP00000000544 9986.ENSOCUP00000000544 ENSOCUP00000000544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]