SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001235 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001235
Domain Number 1 Region: 344-626
Classification Level Classification E-value
Superfamily Kelch motif 8.24e-85
Family Kelch motif 0.0000000000371
Further Details:      
 
Domain Number 2 Region: 72-194
Classification Level Classification E-value
Superfamily POZ domain 9.42e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001235   Gene: ENSOCUG00000001435   Transcript: ENSOCUT00000001434
Sequence length 642
Comment pep:known scaffold:oryCun2:GL018914:396066:404772:1 gene:ENSOCUG00000001435 transcript:ENSOCUT00000001434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQSRGSPPTTPPRASRKRGARVAPSCPVPPHPVGRSHGDLRALRASPRRAAMEAPGLRRR
RRSRSATMAGYTLEDHTKQAFGIMNELRLSQQLCDVTLQVKYEDTPAAQFMAHKVVLASS
SPVFKAMFTNGLREQGMEVVSIEGIHPQVMERLIEFAYTASISMGEKCVLHVMNGAVMYQ
IDSVVRACSDFLVQQLDPSNAIGIANFAEQIGCAELHQRAREYIYMHFGEVAKQEEFFNL
SHCQLVTLISRDDLNVRCESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPHFLQM
QLQKCEILQSDSRCKDYLVKIFQELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLE
AYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQW
SPCASMSVPRNRIGVGVIDGHIYAVGGSHGCLHHNSVERYEPERDEWHLVSPMLTRRIGV
GVAVLNRLLYAVGGFDGTNRLNSVECYYPERNEWRMITPMNTIRSGAGVCVLHSCIYAAG
GYDGQDQLNSVERYDVETETWSFVAPMKHRRSALGVTVHQGKIYVLGGGYDGHTFLDSVE
CYDPDTDTWSEVTRMTSGRSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences ENSOCUP00000001235 9986.ENSOCUP00000001235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]