SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001342 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001342
Domain Number 1 Region: 115-509
Classification Level Classification E-value
Superfamily ARM repeat 1.24e-166
Family B56-like 0.00000000000266
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000001342
Domain Number - Region: 38-76
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0191
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001342   Gene: ENSOCUG00000001560   Transcript: ENSOCUT00000001562
Sequence length 602
Comment pep:known chromosome:oryCun2:12:32484287:32507450:1 gene:ENSOCUG00000001560 transcript:ENSOCUT00000001562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYKLKKXXEPPKLAKGSAKPSSSGKDGGGENAEEAQPQPQPQPQPQPQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
Download sequence
Identical sequences G1SFN5
ENSOCUP00000001342 ENSOCUP00000001342 9986.ENSOCUP00000001342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]