SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001636 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001636
Domain Number 1 Region: 29-152
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.28e-29
Family Hormone receptor domain 0.0016
Further Details:      
 
Domain Number 2 Region: 135-432
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000348
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001636   Gene: ENSOCUG00000001898   Transcript: ENSOCUT00000001897
Sequence length 463
Comment pep:novel chromosome:oryCun2:12:28881206:28915375:1 gene:ENSOCUG00000001898 transcript:ENSOCUT00000001897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAPSPLRLALLLLGAVGRAGPRPQGATVSLSETVQKWREYRRQCQHFLTEAPPLATGL
FCNRTFDDYACWPDGAPGSFVNVSCPWYLPWASNVLQGHVYRFCTTEGHWLHKDNSSLPW
RDLSECEESRRGEKSSPEEQLLSLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAAN
YYWLLVEGAYLYTLLAFAVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFIRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFVKLFTELSFTSFQGLMVAILYCFVNNEKVQMEFRKSWER
WRLEHLRVQRDSSMKPLKCPTSSLSSGATGGSSVYAATSQACS
Download sequence
Identical sequences 9986.ENSOCUP00000001636 ENSOCUP00000001636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]