SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000001676 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000001676
Domain Number 1 Region: 554-659
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 302-404
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000791
Further Details:      
 
Domain Number 3 Region: 146-251
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000648
Further Details:      
 
Domain Number 4 Region: 1-104
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 5 Region: 438-550
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-33
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 6 Region: 679-785
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.72e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000001676   Gene: ENSOCUG00000001946   Transcript: ENSOCUT00000001945
Sequence length 1046
Comment pep:novel scaffold:oryCun2:GL018813:26476:80466:1 gene:ENSOCUG00000001946 transcript:ENSOCUT00000001945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLVGGSGRCSGRVEVFHQGAWGTVCDDLWDLNEAEVVCRQLGCGWAVSALGKAQFGPGS
GDIFLDNLQCAGVERYLGQCTHSGWSEHNCDHHEDASAICSEMRGAGLRAPDRGCPPTAP
PTSELVLMDPSWVSGDSRTMSLCAGDWPELRLVDGSGRCSGRVEVLHQEAWGTVCDDLWD
LNEAEVVCRQLGCGRAVSSPGEAHFGPGSGDIFLDNLECTGVESYLGQCAHLGWSEHNCG
HHEDAGVICSALKPRNGCCPWLYVTPVVQGINLHLSKIHPTSSWHPTSPVTQHWDPEDGP
MLQLVGGSGRCLGRVEVFHQGAWGTVCDDLWDLNEAEVVCRQLGCGRAIAAPGKAYFGPG
SGNILLDNIQCSGSESHLGQCPSSSWSDHNCGHHEDAGVICSGSLSGQTGHPEPFLRTQQ
TGQPWHIRDSSLAEGSNSCGGMLSSLSGAFSSPWYPANYPTNVECVWVLHVAEKFHIELR
IPSLELEDIYGCPYDFLEVFDGRQAASRSMGRFCAGAELTFLSSSNIMTVVFRSDSVVTS
TGFRALYSAVEQDAHMSLRLVNGSHRCEGRVEVSYNGTWGTVCDDGWDLSDARVVCQQLG
CGDALSAPPQSYFDGGTGHILLDDMQCTGAEAKVWQCRHSGWFSHNCGHHQDASAICSGI
DGSPDAAPADDDLQCGGLLTNSSGSLSSPWYPRKYPTNVVCAWDIQVDSRARIKLTFQVV
KLENFYGCPYDFIEIFDGPQSEPFSLGKFCSGAARVFTSSANHLTVVFHSDAIITNSGFH
ASYESLVPDENDAARLSCFPHLFQAVIDRGYLRRLGYSSWDMRVNDELCRPRVTGHYLIF
SIPYGRCGTVRQEHRGSLSYSNSIRGRKHGHPGRVIVRHKVPQLKFTCRVDISSADGITH
GADTPLGSAHYDVSISFLQSPASQPGRGLAPHYASQREEVFLQATLHSQDPSLRLFVDTC
VASPDPHDFETVKYDLIRQGCVRDNTYSSLPSRQKNVAQFKFNAFSFLDSYDVVYLQCKV
AVCRVGDPASRCSRGCVGRSRREAGS
Download sequence
Identical sequences G1SGG8
9986.ENSOCUP00000001676 ENSOCUP00000001676 ENSOCUP00000001676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]