SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002076 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002076
Domain Number 1 Region: 5-326,439-471
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-48
Family FAD-linked reductases, N-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 312-421
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.51e-22
Family L-aminoacid/polyamine oxidase 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002076   Gene: ENSOCUG00000002403   Transcript: ENSOCUT00000002401
Sequence length 477
Comment pep:known chromosome:oryCun2:13:31807850:31811480:-1 gene:ENSOCUG00000002403 transcript:ENSOCUT00000002401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRTVVVLGGGISGLAASYHLSRAPRPPKVVLVEGSERLGGWIRSVRGPGGAVFELGPRG
IRPAGALGARTLLMVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGFRGLLRPSP
PFSKPLFWAGLRELTKPRGKEPDETVHSFVQRRLGPEVASLAMDSLCRGVFAGNSRELSI
RSCFPSLFQAEQTHRSILLGLLLGAGQSPPPDSALIRQARAERWSQWSLRGGLEMLPQAL
DTHLTSRGVQVLRGQPVCRLSLQAGGRWKVSLGDSSLEADHIISAIPAPALSKLLPAEAA
PLARVLSTITAVSVAVVNLQYRGAHLPVQGFGHLVPSSEDPGVLGIVYDSVAFPEQDGSP
PGLRVTVMLGGSWLQTLEASGRVLPQELFQQQAQEAAATQLGLKEPPSHCLVHLLKNCIP
QYTVGHWQKLESAMQFLAAQRLPLTLAGASYEGVAVNDCIESGRQAAASVLGTEPDS
Download sequence
Identical sequences G1SHH1
9986.ENSOCUP00000002076 ENSOCUP00000002076 ENSOCUP00000002076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]