SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002527 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002527
Domain Number 1 Region: 426-537
Classification Level Classification E-value
Superfamily SH2 domain 7.81e-33
Family SH2 domain 0.00000519
Further Details:      
 
Domain Number 2 Region: 102-198
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-32
Family Ras-binding domain, RBD 0.00037
Further Details:      
 
Domain Number 3 Region: 229-343
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000548
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002527   Gene: ENSOCUG00000002909   Transcript: ENSOCUT00000002908
Sequence length 540
Comment pep:novel chromosome:oryCun2:7:103860156:103986957:-1 gene:ENSOCUG00000002909 transcript:ENSOCUT00000002908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSLQDGQSAADRAAARDSPLAAQVCGAAQGRDDAHDPARAPWLHARALVPAPDGTRGC
AADRRKKKDLDVLETPSIPNPFPELCCSPFTSVLSAGLFPKANSRKKQVIKVYSEDETSR
ALEVPSDITARDVCQLLILKNHYVDDHSWTLFEHLPHIGVERIIEDHELVTEVLSNWGME
EENKLFFRKNYAKYEFFKNPMYFFPEHMVSFATETNGEISPTQILQMFLSSTTYPEIHGF
LHAKEQGKKSWKKIYFLLRRSGLYFSTKGTSKEPRHLQFFSEFGSSDIYVSLTGRKKHGA
PTHYGFCFKPNKAGGPRDLKMLCAEEEQSRTCWVTAIRLLKYGMQLYQNYMHPYQGRSGC
SSQSISPMRSISENSLVAMDFSGQKSRVIENPTEALSVAVEEGLAWRKKGCLRLGVHGSP
TASSQSSAANMAIHRSQPWFHHKISRDEAQRLIIQQGLVDGVFLVRDSQSNPKTFVLSMS
HGQKIKHFQIIPIEDDGAMFHTLDDGHTRFTDLIQLVEFYQLNKGVLPCKLKHYCARMAL
Download sequence
Identical sequences G1SIL3
XP_008256901.1.1745 ENSOCUP00000002527 ENSOCUP00000002527 9986.ENSOCUP00000002527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]