SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000002661 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000002661
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-79
Family Protein kinases, catalytic subunit 0.00000000139
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-37
Family SH2 domain 0.0000085
Further Details:      
 
Domain Number 3 Region: 66-175
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-23
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000002661   Gene: ENSOCUG00000003056   Transcript: ENSOCUT00000003059
Sequence length 512
Comment pep:novel chromosome:oryCun2:3:71500990:71567621:1 gene:ENSOCUG00000003056 transcript:ENSOCUT00000003059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKRKDNLNDDGVDLKTQPVRNTDRTIYVRDPTSNKQPRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHQDDLSFKKGEKMKVLEEHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences G1SIY6
XP_002710543.1.1745 ENSOCUP00000002661 9986.ENSOCUP00000002661 ENSOCUP00000002661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]