SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003013 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003013
Domain Number 1 Region: 4-120
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.27e-29
Family Hormone receptor domain 0.00014
Further Details:      
 
Domain Number 2 Region: 106-389
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000714
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003013   Gene: ENSOCUG00000003473   Transcript: ENSOCUT00000003474
Sequence length 424
Comment pep:known chromosome:oryCun2:13:8134498:8237842:1 gene:ENSOCUG00000003473 transcript:ENSOCUT00000003474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEQVSSIHPECRFHLEIQEEETKCAELLSAQTEKYKACSGVWDNITCWRPADVGETVTVP
CPKVFSNFYSKPGNISKNCTSDGWSEIFPDFVDACGYSDLEDEGKITFYILVKAIYTLGY
SVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFMLRAVSVLVKDDILYSSSGTLHCPD
QPSSWVGCKLSLVFFQYCIMANFYWLLVEGLYLHTLLVAIFSPNRCFLAYLLIGWGVPTV
CIGAWTVARLSLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFVSIIRILLQKLTSPD
VGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIGISSKYQILFELCIGSFQGLVVAVL
YCFLNSEVQSELKRKWRGLCPTQPRSRDYRLHGSSMSRHGSESALQFHRGSRAQSFLQTE
TSVI
Download sequence
Identical sequences ENSOCUP00000003013 9986.ENSOCUP00000003013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]