SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003181 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003181
Domain Number 1 Region: 232-501
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-81
Family Protein kinases, catalytic subunit 0.000000000176
Further Details:      
 
Domain Number 2 Region: 122-266
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-32
Family SH2 domain 0.0000018
Further Details:      
 
Domain Number 3 Region: 64-147
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-21
Family SH3-domain 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003181   Gene: ENSOCUG00000003668   Transcript: ENSOCUT00000003670
Sequence length 510
Comment pep:novel scaffold:oryCun2:GL018704:5907643:5916972:-1 gene:ENSOCUG00000003668 transcript:ENSOCUT00000003670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLEGKATLPIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLDSGKSESTAGSFSLSVRDFDQNQGEVVK
HYKIRNLDNGGFYISPRITFPGLHELVRHYTSAPDGLCTRLSRPCQTQKPQKPWWEDEWE
VPRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQR
LVRLYAVVTQEPIYIITEYMENGSLVDFLKTPTGIKLTINKLLDMAAQIAEGMAFIEERN
YIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTI
KSDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPENCPEELYHLMKLCWKE
RPEDRPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences G1SK64
ENSOCUP00000003181 ENSOCUP00000003181 XP_002720675.1.1745 9986.ENSOCUP00000003181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]