SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000003553 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000003553
Domain Number 1 Region: 155-454
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-74
Family Protein kinases, catalytic subunit 0.0000662
Further Details:      
 
Domain Number 2 Region: 1-114
Classification Level Classification E-value
Superfamily DEATH domain 8.01e-37
Family DEATH domain, DD 0.0000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000003553   Gene: ENSOCUG00000004103   Transcript: ENSOCUT00000004105
Sequence length 461
Comment pep:known chromosome:oryCun2:8:2529467:2548158:-1 gene:ENSOCUG00000004103 transcript:ENSOCUT00000004105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKPISPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAAAIKKPSGDDRYNQLHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPADALPKTVNTLPAKEAIT
AQQKLIPFHDKGKTSVIPVQNLEKNCVLPDSSSPENKSLGVSDTRFHSFSFYELRSITND
FDERPIARGGNKMGEGGFGVVYKGCLRNTPVAVKKLAAMVDISTEELKQQFEQEIKVMAK
CQHENLVQLLGFSKDGDDLCLVYVYMPNGSLLDRLLCLDDTAPLSWHTRCNIAQGAAAGI
SFLHENHHIHRDIKSANILLDKAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEA
LRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYVDTKMS
DAEPSSVESMYSVACQCLHEKKNKRPDIKKVQQLLQEMIPS
Download sequence
Identical sequences 9986.ENSOCUP00000003553 ENSOCUP00000003553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]