SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004315 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004315
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 2 Region: 310-414
Classification Level Classification E-value
Superfamily SRCR-like 6.8e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 3 Region: 422-539
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-25
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00088
Further Details:      
 
Domain Number 4 Region: 177-296
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004315   Gene: ENSOCUG00000004988   Transcript: ENSOCUT00000004986
Sequence length 759
Comment pep:known chromosome:oryCun2:18:46350107:46364824:-1 gene:ENSOCUG00000004988 transcript:ENSOCUT00000004986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWSSPATFSLFLLLLLLLGQAPPSNPQSLGTVKLRLVGPGSRPEEGRLEVLHQGQWGTV
CDDDFGLQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCGGTESSLDQCGSNGW
GVSDCSHSEDVGVVCHPKRQRGYFSEKVSNALGPQGRRLEEVRLKPILASAKRRLPVTEG
AVEVKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVNNPYYRKVWNLKLKDPKSRLKG
LTNKNSFWIHRVNCLGTEPHMANCQVQVAPAQGKLRPACPGGMHAVVNCVAGPRFRPPKA
KPRRKESREEELRVRLRSGAQVGEGRVEVLMNRQWGTVCDHRWDLISASVVCRQLGFGSA
REALFGAQLGQGLGPIHLSEVRCRGYERTLSDCLALEGSQNGCQHDNDAAVRCNVPDMGF
QSQVRLAGGRSPEEGIVEVQVEVNGVQRWGTVCSDHWGLNEAMVVCRQLGLGFASHAIKD
TWYWQGTPGAGEVVMSGVGCLGTEQALQQCQRHGPVHCSHGTGRFSAGVSCTSSAPDLVM
NAQLVQETAYLEDRPLSLLYCAHEENCLSRSADHMDWPYGHRRLLRFSSQIYNLGRADFR
PKTGRHSWIWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPAGMQRRYA
CANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGDYIFQVVVNPKYEVAESDFSNNMMRC
RCKYDGHRVWLHNCHTGDSYRANAELSLEQEQRLRNNLI
Download sequence
Identical sequences G1SMY4
XP_002718663.1.1745 ENSOCUP00000004315 9986.ENSOCUP00000004315 ENSOCUP00000004315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]