SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004853 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004853
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 8.24e-57
Family N-terminal domain of cbl (N-cbl) 0.00000141
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-42
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 6.03e-37
Family EF-hand modules in multidomain proteins 0.0000106
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000004853
Domain Number - Region: 927-970
Classification Level Classification E-value
Superfamily UBA-like 0.000148
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004853   Gene: ENSOCUG00000005590   Transcript: ENSOCUT00000005591
Sequence length 983
Comment pep:novel chromosome:oryCun2:14:114283513:114512764:1 gene:ENSOCUG00000005590 transcript:ENSOCUT00000005591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQADPLQIPHLSLPPVPPRLDLIQKGIARSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPENRLSRHFHHVESVPCRDQPMPLEAWCPRDVFG
TNQLVGCRILGDGSPKPGITASSNVNGRHSRMGSDPVLMRKHRRHDLPLEAAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPGVKCTGPLANSLSEKTKDLVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPTVRSCDNGHCILNGTHGTSSEMKKSNIPELGIYLKGDVFDSASDPVPLP
PARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLVEPSKPP
GSGSRPSSGQDLFLLPSDPFFDPASGQVPLPPARRLPGENVKSNRTSQDYDQLPSSSDGS
QAPARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNN
VEVARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences G1SP98
XP_002716770.1.1745 XP_008265228.1.1745 ENSOCUP00000004853 9986.ENSOCUP00000004853 ENSOCUP00000004853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]