SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005346 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005346
Domain Number 1 Region: 303-369
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 3.79e-19
Family Small-conductance potassium channel 0.00069
Further Details:      
 
Domain Number 2 Region: 180-267
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000000314
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005346   Gene: ENSOCUG00000006168   Transcript: ENSOCUT00000006169
Sequence length 421
Comment pep:novel scaffold:oryCun2:GL018881:158625:168928:-1 gene:ENSOCUG00000006168 transcript:ENSOCUT00000006169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGELVPGLGALRRRKRLLEQEKWLAGWALALAGIGIGLMVLHAEMLWFGGCPWALYLFL
VKCMISGSTFLLLCLIVAFHAKEVQLFMTDNALRDWRVALTGRQAAQILLELAVCGLHPA
PVRGPPCAQGSGTPAWPGFLDQGEALLSLAMLLRLYLVPRAVLLRSGVLLNASYRSIGAL
NQVRFRHWFVAKLYMNTHPGRLLLGLTLGLWLTTAWVLSVAERQAVNATGHLSDTLWLIP
ITFLTIGYGDVVPGTVWGKIVCLCTGVMVSVALQPPETRRRLRSGQCWAVSIALSDGQVN
HRETPSGASSCLEEPWXMYYKHTRRKESGATRRHQRRLLAAIHTFRQVRLKHRKLREQVN
SMVDISKMHMILSDLQLGLSSSHQALEKRIDALAGKLDALAELLGAALGPQQRPAPSQEA
T
Download sequence
Identical sequences G1SQG9
9986.ENSOCUP00000005346 ENSOCUP00000005346 ENSOCUP00000005346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]