SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005567 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005567
Domain Number 1 Region: 160-347
Classification Level Classification E-value
Superfamily PH domain-like 8.46e-57
Family Phosphotyrosine-binding domain (PTB) 0.00000041
Further Details:      
 
Domain Number 2 Region: 510-611
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-25
Family SH2 domain 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005567   Gene: ENSOCUG00000006438   Transcript: ENSOCUT00000006439
Sequence length 630
Comment pep:novel chromosome:oryCun2:17:23456272:23595550:1 gene:ENSOCUG00000006438 transcript:ENSOCUT00000006439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERGQDCPAGLVLCVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKGSPQPPC
PALAPHLPAEDATLPSQESPTPLCTLIPRMASMKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSLSRAGSAPPPQPDLLGHRATALTPNACPLPGPGEPAPRPRQDKQ
YLQHLLGMGMNYCVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKKRK
PPVKFLSTVLGKSNLQFSGTNIKLTISTCSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNASCESEEV
HIDGPAEEREGPEYYNEIPGKQPPAGGVSDVRAKVQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNTHERGVPFPREASLMKHTCRVDLFDDPCYINTQALQSTLGCARD
QSSGQPPGNSWHRGKTPETVQPGATAQPASSHSLPHIKQQLWNEECYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIVSSGSEVSLKQPVRKDNTPGLLQSKK
Download sequence
Identical sequences G1SR04
ENSOCUP00000005567 ENSOCUP00000005567 XP_008267264.1.1745 9986.ENSOCUP00000005567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]