SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005703 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005703
Domain Number 1 Region: 52-282
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.55e-72
Family Calnexin/calreticulin 0.0000000372
Further Details:      
 
Domain Number 2 Region: 260-398
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.7e-57
Family P-domain of calnexin/calreticulin 0.000000318
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000005703
Domain Number - Region: 401-445
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000142
Family Calnexin/calreticulin 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005703   Gene: ENSOCUG00000006597   Transcript: ENSOCUT00000006599
Sequence length 615
Comment pep:novel chromosome:oryCun2:15:24168166:24209228:1 gene:ENSOCUG00000006597 transcript:ENSOCUT00000006599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFKDFWLGLGLLFISINAEFLDDGVEMEDLEENSEETDVNTGETSSEVKYKTPQPIGEV
YFAETFDSGKLAGWVLSKAKKDDSDAEISIYDGRWEIEELKENRVPGDRGLVLKSRAKHH
AISAILAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTGDLALENFYDKTSYTIMF
GPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFE
VLIDQILVNKGSLLEDVVPPINPPKEIDDPSDKKPDEWDERAKIPDPSAVKPEDWDENEP
AQIEDSNVSKPDGWLDDEPKFIPNPNAEKPDDWNEDMDGEWEAPHIPNPACRIGCGEWKP
PMIDNPKYKGIWRPPLIDNPNYQGIWSPQKIPNPDYFEDNHPFLLTSFRALGLELWSMTS
DIYFDNFIICSEKEIADRWAADGWGFKIMIANANEPGIFIQLMAAAQERPWLWLIYFVTA
GLPVALVTSFCWPKKVKKKYEDADYKKTDICKPQTKGALEQDVKEQEVTEEKAALEKPAD
VEEEKKPSDGEVLEKEEEGDAEEKSEEEVETVEGQEEGNKSHKSGSEDEMKEADESTGSG
DGPVKSVRKRRVRKD
Download sequence
Identical sequences 9986.ENSOCUP00000005703 ENSOCUP00000005703 XP_008265641.1.1745 XP_008265642.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]