SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005878 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005878
Domain Number 1 Region: 44-229,353-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.55e-50
Family FAD-linked reductases, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005878   Gene: ENSOCUG00000006799   Transcript: ENSOCUT00000006797
Sequence length 476
Comment pep:novel chromosome:oryCun2:20:31059434:31072873:-1 gene:ENSOCUG00000006799 transcript:ENSOCUT00000006797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPVQIGGMAARLVVSRWAAAPVAARAGPLVTCRRWSGAAADTVYDVVVSGGGLVGAAMAC
ALGYDIHFRDKKILLIEAGPKKVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRY
RAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAV
SYTWPCPFLMADSSPWVQITLGDGSTLQTKLLIGADGHNSGVRQAAGIPNVSWNYDQSAV
VATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHEHAAELVRMDEEQFVDA
VNSAFWSDANHTDFVDSAGSLLQHALALLRPTKVSARQLPPSVARVDAKSRVLFPLGWGH
AAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLAHHLSSAAFNGRDLGSMSHLTGY
ETERQRHNTALLAATDLLKRLYSTRATPLVLLRTWGLQATNAVSPLKGQIMAFASK
Download sequence
Identical sequences G1SRQ9
ENSOCUP00000005878 9986.ENSOCUP00000005878 ENSOCUP00000005878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]