SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007024 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007024
Domain Number 1 Region: 80-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000812
Family LDL receptor-like module 0.0039
Further Details:      
 
Domain Number 2 Region: 163-204
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000007024
Domain Number - Region: 128-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000117
Family LDL receptor-like module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007024   Gene: ENSOCUG00000008126   Transcript: ENSOCUT00000008125
Sequence length 206
Comment pep:novel chromosome:oryCun2:13:112767378:112775536:1 gene:ENSOCUG00000008126 transcript:ENSOCUT00000008125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPQGDGTGNAAARTKTLSRGEADCSPLCCSRRGACLSASLLLLLATLAALVALAII
LGLPPRTPGAQACVTRTNRTGFLCHDRRSCIPASGVCDGIRTCTHGEDEDEALCRDAPRS
LPGFLVARCGDPASWIYSDQKCDGTNHCGDCSDELSPVSACPPCGPGWWRCPPTVFKYCS
CIPRSLCRDHVQHCSDWSDEYSCPGL
Download sequence
Identical sequences G1SUI8
9986.ENSOCUP00000007024 XP_002715657.1.1745 ENSOCUP00000007024 ENSOCUP00000007024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]